PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3728_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 551aa    MW: 59805.1 Da    PI: 7.4437
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3728_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.43.7e-42177253278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    Cqv gC++dls+ k+yh+rhkvCevhska++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  Neem_3728_f_2 177 CQVYGCNKDLSSSKDYHKRHKVCEVHSKAAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQD 253
                    **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.701174251IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.1E-33174238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.22E-38175254IPR004333Transcription factor, SBP-box
PfamPF031101.8E-32177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MESWSYVSGG QESVANDTIS RCDSSSRSKN SLMGWELSTP RRFGNNILVS DQEAIHNQSF  60
GKFSGQESVG KRLPNDSVRD VSGSKYGSGR VMNPIIPTPN KSFGEDDSTS RLSNSAVDSN  120
SSHDSFLIDL NLGRFVDQRD LHSTKFSHGA PILSSSESST PPKRVRLSAI SLHAAFCQVY  180
GCNKDLSSSK DYHKRHKVCE VHSKAAKVIV NGIEQRFCQQ CSRFHLLAEF DDGKRSCRKR  240
LAGHNERRRK PQDNRSQSAS ADSKFEGTKL TMSSFVCQDI LPGGLFHPQK CGTNDWFKSI  300
KIEEGTAYNS LSATPITNGN LHYKSFSPHY GFEKVVPSFH GNEANTAAES IFSFNSTRHP  360
HDMGGPNSGS SLLFQETTMG SEDFTVFDTA STIQGLSGIA GSGCALSLLS PKSQNSSSHL  420
SGIPAAHALV IPGSSTHFNI GQVSEKLPGG SSQASTGGVS NKFSSTGNNS VEGSNLGSIL  480
MSDSSDAANF DIGNGIYRGL DFMNPKDRLS CEDGATIDLL QLSSQLQRVE HQRQSMEVKD  540
ENDSFCWLRI T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-301762501084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818135e-32LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132565e-32LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477709.10.0PREDICTED: squamosa promoter-binding-like protein 12 isoform X1
TrEMBLA0A067FHU90.0A0A067FHU9_CITSI; Uncharacterized protein
STRINGVIT_17s0000g05020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14770918
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-45SBP family protein